Stay updated with the latest news from our blog

The Best URLGenius Alternative in 2024

The Best URLGenius Alternative in 2024 advance deep linkalternativeAPIapp deep linkbrandbranded linkbusinesscorporate level apiCTAdeep linkdeep linkingdeferred deep linksdigital marketingearningsgrowinstaurlintegrationsjoturllinklink in biolink managementmarketingmobile deep linkingmobile marketingmonitoringomnichannel toolplanpricingqr codesremarketing pixelsocial mediasocial optintrackurlurlgeniusurlgenius alternative

Year 2024. The world of digital marketing is moving more and more towards the mobile sector, it is undeniable, there are many studies ...

New JotURL Chrome Extension: Empower your Deep Links Generation

New JotURL Chrome Extension: Empower your Deep Links Generation affiliate linksaffiliate marketingAIappapp linkbranded linkschromechrome extensiondeep linkdeep linkingeasy deep linkingjoturlmobile marketingsocial media marketingtracking links

In this article, we are going to analyze the new JotURL Chrome Extension, which now allows you to create Deep Links in just a few ...

4 Advanced Retargeting Techniques in Digital Marketing Every Marketer Can Use

4 Advanced Retargeting Techniques in Digital Marketing Every Marketer Can Use analyticsconversiondigital marketingjoturllinkpixelretargetingsocial mediaurl

Imagine a customer walks into your store, browses through products, and leaves without making a purchase. There’s no tracking to remind

THE EASIEST WAY TO CREATE A DEEP LINK TO MAVELY

THE EASIEST WAY TO CREATE A DEEP LINK TO MAVELY affiliate linkaffiliate marketingappapp linkconversiondeep linkdeep linkingjoturlmavelymobile marketingtracking link

Aim of the article: discover and analyze the best way to create a deep link to Mavely. We are going to talk about Deep Linking and ...

How Creator Marketing Can Give Your Brand an Edge in 2024

How Creator Marketing Can Give Your Brand an Edge in 2024 brandcontent marketingdeep linkdeep linkingdigitaldigital marketinginfluencer marketingmarketingsocial media marketingurl

The modern consumer wants brands to entertain and inform them without overtly promotional messages and biased product recommendations. ...

13 Best WordPress Plugins to Generate Content with AI

13 Best WordPress Plugins to Generate Content with AI AIcontent creationdigital marketingguest postjoturlmarketingsocial mediasocial media marketingwordpress plugin

Artificial intelligence (AI) has already made its way into various industries including content creation. Businesses, creators, and ...

JotURL Integrations: Improve Your Workflow 

JotURL Integrations: Improve Your Workflow  AIautomationdigital marketingemail marketingintegrationintegrationsjoturllead generationlinksocialsocial mediasocial media marketingtracking link

In the dynamic realm of digital marketing, leveraging the right tools can be the key to unlocking success. JotURL, a cutting-edge link ...

New AI-Driven Call-To-Actions – Embed every content

New AI-Driven Call-To-Actions – Embed every content AIbranded linkcall to actionscontent creationcontent curationCTAjoturllead generationlinkmarketingproduct huntsocial mediatracking linksurl

We recently released a new feature within JotURL: the new CTAs with AI Preview to embed every content. In this article, we will explain

11 Deal-Days of Black Friday in 2023

11 Deal-Days of Black Friday in 2023 affiliate linkamazon deep linkingblack fridaybranded linksdeep linkdeep linkingdigital marketingeasy deep linkingjoturlsocial media marketingtracking link

As an Amazon Ad Network Partner, we can inform you that 2023 will be a truly special year for Black Friday. We have usually been ...

A complete Guide to promote your Twitch Channel in 2023

A complete Guide to promote your Twitch Channel in 2023 affiliate linkapp deep linkingCTAdeep linkdeep linkingdigital marketingjotbiojoturllinklink in biosocial mediatracking linktwitch

In the digital landscape of 2023, Twitch streamers have risen to prominence as the new age of entertainment. This live-streaming ...

Social Media Marketing 101: Building Your Brand in the Digital Age

Social Media Marketing 101: Building Your Brand in the Digital Age branded linksdigital marketingguest postjoturllinkmarketingsocial mediasocial media marketing

In this article we will analyze how to best build your digital identity in 2023. There will be generalized overviews on the topic, ...

THE EASIEST WAY TO CREATE A DEEP LINK TO WALMART

THE EASIEST WAY TO CREATE A DEEP LINK TO WALMART appapp deep linkingdeep linkdeep linkingdigital marketingeasy deep linkingjoturllinkmobile marketingretailersurl

The main objective of this article is to show you the simplest possible way to create a Deep Link to Walmart, using this technology ...

The Role of Video Marketing in Driving Conversions and ROI

The Role of Video Marketing in Driving Conversions and ROI branded linksconversionCTAdigital marketingjoturlmarketingqr codesROIsocial mediatracking linkvideo marketing

Businesses are constantly seeking innovative ways to capture the attention of their target audience and drive higher returns on their ...

Crafting SEO-Friendly URLs: Best Practices Revealed

Crafting SEO-Friendly URLs: Best Practices Revealed branded linksdigital marketingjoturllinksmarketingseo-friendly urls

The world of SEO is full of tiny details. When combined, they draw a picture of a perfect website. One of those details is crafting ...

Top 5 Strategies For Influencer Marketers Using JotURL

Top 5 Strategies For Influencer Marketers Using JotURL affiliate linkaffiliate programappapp deep linkbranded linksconversionsCTAdeep linkdigital marketingeasy deep linkinfluencer marketersjotbiojoturllanding pagelink in biomobilemobile marketingqr codesstrategies

The goal of this article is to explain and show you the top 5 strategies for influencer marketers using JotURL. The phenomenon of ...

Tracking Your Content: A Guide to Branding and Analytics for Digital Marketing

Tracking Your Content: A Guide to Branding and Analytics for Digital Marketing analyticsdigital marketingguest postjoturllinkomnichannel marketingtracking link

When it comes to business, marketing plays a critical and decisive role in a brand’s success. That’s why it is so important to do your ...

The best tool for influencer marketing in 2023

The best tool for influencer marketing in 2023 affiliate marketingappapp deep linkcontent creatorconversiondeep linkdeep link generatordeep linkinginfluencerinfluencer marketingjoturllinkmobile marketingrevenues

In this article, we’re approaching the exciting world of influencers and influencer marketing in 2023! Over the past few years, this ...

How to Use SEO to Build Your Brand Authority: A Comprehensive Guide

How to Use SEO to Build Your Brand Authority: A Comprehensive Guide brandbrand authoritybranded domainbranded linksbranded qr codescustom link previewguest postSEO

Establishing and maintaining brand authority is crucial for businesses to stand out and build trust with their audience. A strong brand

THE EASIEST WAY TO CREATE A DEEP LINK TO TIKTOK

THE EASIEST WAY TO CREATE A DEEP LINK TO TIKTOK affiliate programappcontent creatorconversionsdeep linkdeep linkingdigital marketingeasy deep linkinfluencer marketingjoturlmobile marketingsocial mediasocial media marketingtiktok

Article Goal: Understand the benefits of Deep Linking and building a Deep Link to TikTok to maximize conversions and content exposure. ...

THE EASIEST WAY TO CREATE A DEEP LINK TO TARGET

THE EASIEST WAY TO CREATE A DEEP LINK TO TARGET amazonappapp deep linkingbranded linksconversionsdeep linkdeep linkingdigital marketingeasy deep linkjoturllinkmobile marketingsocial mediatargettracking link

In 2023, mobile marketing continues to soar to greater heights as digitization and the rise of online shops become more prevalent in ...

THE EASIEST WAY TO CREATE A DEEP LINK TO LTK

THE EASIEST WAY TO CREATE A DEEP LINK TO LTK affiliate linksaffiliate marketingapp deep linkbranded linksdeep linkeasy deep linkjoturlltktracking link

As the digital marketplace expands more and more, in 2023 this phenomenon is pushing harder than ever, more and more users are ...

The best alternative to ClickMeter

The best alternative to ClickMeter a/b testingbest alternativebranded linksbulk importconversion trackingconversionscustom domaincustomer caredeep linkdigital marketinggdprjotbiojoturllink managementqrcodesremarketingretargetingsecuritytracking linkutm parameters

In this article, we will explain to you in a very simple way why JotURL is the best alternative to Clickmeter, analyzing the situation ...

How to avoid QRishing using JotURL Branded QR Codes

How to avoid QRishing using JotURL Branded QR Codes branded linksbranded qr codesdeep linkdynamic qr codesgdprjoturllink managementphishingprevent phishingqr codessecuritytracking link

The use of QR codes has become increasingly widespread throughout the world. While this practice was already well known within the ...

How to get the most conversions possible on Black Friday 2022

How to get the most conversions possible on Black Friday 2022 affiliate marketingamazonamazon affiliation programappsblack fridaybranded linksconversionscyber mondaydeep linkdigital marketingearningseasy deep linkedlfacebookinstagramjotbiojoturllinkltkmarketingmobilemobile devicemobile marketingomnichannel marketingonline marketingretailerssheinsocial mediasocial media marketingstrategiestiktoktracking linkurl

If you are an Affiliate Marketer, you may already be wondering how to get the most conversions possible on Black Friday. In this ...

How To Prevent Phishing with JotURL Branded Links

How To Prevent Phishing with JotURL Branded Links APIbranded domainsbranded linkscertificationsdigital marketingjoturllinklink trustmarketingphishingprevent phishingprotectionsafetysecuritysmishingSSLtracking linkurl

Internet is a place full of resources and incredible possibilities, the digital evolution is pushing brands, marketplaces, and the ...

Can Strategic Marketing Enhance Your Business Strategy?

Can Strategic Marketing Enhance Your Business Strategy? businessbusiness strategydigital marketingenterpriseenterprise marketing strategygrowthgrowth strategiesjoturlmarketingmarketing goalsmarketing strategiesstrategic marketingstrategy

How difficult it is to develop in business when you are just beginning to understand all its disadvantages and difficult situations. ...

The Power of Revitalizing Your Mobile App: How SEO and ASO Work Together to Help Fuel Your Growth

The Power of Revitalizing Your Mobile App: How SEO and ASO Work Together to Help Fuel Your Growth appapp deep linkapp storeapp store optimizationasoconversiondeep linkdeep linkingdeferred deep linkingdeferred deep linksdigital marketingjoturllinkmarketingmobile devicemobile userSEOseo optimizationsocial mediasocial media marketing

Apps used to be reserved for only big-name businesses. With the accessibility and ease of creating your own app, however, more and more

Mobile CRO: 14 Actionable Ways to Increase Your Mobile Conversion Rates

Mobile CRO: 14 Actionable Ways to Increase Your Mobile Conversion Rates appapp deep linkconversionconversion ratecrodeep linkdigital marketingeasy deep linkjoturllinkmarketing strategiesmobilemobile conversion ratemobile deep linkingmobile devicemobile marketingsocial mediasocial media marketingstrategies

These days, mobile traffic contributes to more than half of the internet traffic worldwide.As such, it is safe to say that more and ...

Lead Generation Blogging: How to Get Leads for Business [2022]

Lead Generation Blogging: How to Get Leads for Business [2022]

No matter what your business is, getting leads is probably one of the most important things on your mind. In a perfect world, leads ...

How To Collect The Right Data To Write A Killer Landing Page

How To Collect The Right Data To Write A Killer Landing Page analyticsbusiness strategydatadata collectiondigital strategyjoturllanding pagelanding pageslink managementmarketingsocial mediatrackingtracking linksurl

Data is paramount for businesses of all types and sizes. This is because data helps you improve your business by understanding your ...

How to Develop a Successful Marketing Automation Strategy

How to Develop a Successful Marketing Automation Strategy adsautomation strategybusinessCTAdigital marketingdigital strategyintegrationsjoturllead generationleadslinkmarketingmarketing automationmarketing campaignmarketing effortmarketing goalmarketing toolsnewslettersocial mediasocial media marketingtooltracking link

The growing number of Internet users and plenty of affordable marketing software encourages companies to continuously reconsider their ...

How To Utilize Visual Content Marketing To Drive Conversions

How To Utilize Visual Content Marketing To Drive Conversions brandbrand identitycontent marketingdigitaldigital communicationdigital marketingdigital strategyjoturlmarketingmarketing strategymediasocial mediasocial media marketingstrategy

Online content marketing is one of the most important business strategies in the modern world. With more and more people tuning into ...

How To Market And Attract Global Buyers

How To Market And Attract Global Buyers adsbusinessdigital marketingglobalgrowthjoturlmarketingmarketing strategiesmarketing toolssocialsocial mediasocial media marketing

Global marketing can be challenging. Whether you’re targeting buyers in the United States, Europe, or elsewhere worldwide, it’s ...

How to Optimize a Marketing Strategy for Cross-Channel Conversions

How to Optimize a Marketing Strategy for Cross-Channel Conversions clientcontent strategycross-channelcustomizedatajoturlmarketingmarketing strategiesomni-channel toolOmnichannelperformanceretargetingretargeting pixelsocial mediasocial media marketingstrategy

Your consumers are everywhere. They can see ads in the street and communicate with your brand on social media. That’s why your business

User Engagement: Why You Might Be Leaving Money On The Table?

User Engagement: Why You Might Be Leaving Money On The Table? audienceclicksclientctrengagementfunneljoturllinktooluseruser engagementusers

Whenever a company wants to succeed, it is essential to create a product that is so essential to the lives or work of the client that ...

Social Media Branding: How to Create a Brand Identity in 2021

Social Media Branding: How to Create a Brand Identity in 2021 analyticsbrandbrand identitybrand marketingbranded linksclicksdigitaldigital marketingjoturllinklink monitoringlink trustlinksmarketingmonitoringmonitoring toolsocial mediatracking linkurl

Social media has already become an excellent tool for businesses. Most of the brands have accounts on Facebook, Instagram, YouTube, and

How to use Branded Links To Find Job Opportunities

How to use Branded Links To Find Job Opportunities branded domainbranded linkbranded linksbranded urlcustom branded linkscustom linkcustom urldigital marketingemailjoturl linkslinklinkspersonal brandingsocial mediasocial media marketingsocial networkurlurl shortener

We have talked a lot about our branded links in many articles, and we have explained how to use them, how they can be created, and what

11 Best Lead Generation Software To Get More Leads

11 Best Lead Generation Software To Get More Leads branded linksbusinessbusiness strategycall to actionscustomerdigital marketingdigital strategyintegrationsjoturlleadlead acquisitionlead generationleadslinksmarketingqualified leads

What is the first goal when devising the marketing strategies? Lead generation. Without this, it isn’t possible to bring in sales or ...

Complete Guide For Writing Content That Performs Well

Complete Guide For Writing Content That Performs Well backlinksbrandbrand identitycontentcontent strategyjoturljoturl linkjoturl link shortenerjoturl linkslinklink managementlinkstargeted audiencetracking link

Writing compelling content has been the focus of digital marketing and, more specifically, content marketing for a long time now. Yet, ...

Top 6 TikTok Marketing Strategies

Top 6 TikTok Marketing Strategies adsanalysisanalyticsbrand awarenessbranded domainsbranded linksCTActrdeep linkdeep linkingdigital marketingjotbiolanding pageslinksmarketing campaignmarketing goalsqr codesremarketingremarketing codesocialsocial media marketingsocial networksstrategiestiktoktracking linktracking links

In 2020 it is essential to exploit new tools and reinvent your marketing campaigns to achieve visibility and success, so today we will ...

Digital communication strategy of a modern enterprise

Digital communication strategy of a modern enterprise chatbotcontent strategycoronaviruscovid-19customer servicecustomersdigitaldigital communicationdigital marketingdigital strategymarketingmarketing goalsmarketing strategiesmarketing toolmeetingsmobilemobile devicemobile marketingstrategytechnologyvideo

Internal and external communication is the backbone of a modern enterprise, with leading business entities spending huge amounts of ...

7 Common Email Signature Mistakes to Avoid

7 Common Email Signature Mistakes to Avoid businessdigitaldigital marketingemailemail marketingemail signaturemarketingmarketing strategiesmarketing tips

Everyone these days of any professional capacity has an email signature which they use. This is usually something succinct and ...

5 Main Online Marketing Trends of 2021

5 Main Online Marketing Trends of 2021 AIanalyticsaudienceblogbrandbrand marketingbusinessbusiness strategycontentcontent strategycustomersdatadata-drivendigital marketingguest postinstagraminstagram storiesjoturlmarketingmarketing goalsmarketing strategiesmarketing trendssocial mediasocial media marketingsocial networksocial networkstargettarget audiencetiktokuservlogwebinar

Marketing is one of the essential things for running your business successfully. The content marketing done right connects you to your ...

THE EASIEST WAY TO CREATE A DEEP LINK TO SPOTIFY

THE EASIEST WAY TO CREATE A DEEP LINK TO SPOTIFY appapp deep linkapp deep linkingappsbranded deep linkbranded domainbranded linkbranded linksbranded urlcontent strategyconversion rateconversionsctrcustom branded linksdeep linkdeep link generatordeep linkingdeep linksdigital marketingeasy deep linkengagementjoturljoturl linkslinklink managementlink previewlinksmarketingmarketing strategiesmobilemobile deep linkingmobile devicemobile marketingmusic marketingopen graphshortenersocial mediasocial media marketingsocial networksspotifystrategiesurlurl shorteneruser

Spotify is an application that allows you to listen to albums and songs or hundreds of different podcasts with free services or with ...

6 Reasons to Use URL Shorteners in Your Ads

6 Reasons to Use URL Shorteners in Your Ads adsanalyticsbranded domainbranded linksbranded urlbusinesscustom urlcustom url shortenercustomersdigital marketinggrowth strategiesjoturljoturl link shortenerlinklink shortenerlink trustlinksmarketingmarketing strategiesshort linkshort linksshort urlshortened urlshortenerurlurl shortenerurlsvanity url

When you’re running a campaign online and trying to reach your target audience, you need to take care of every single detail to ...

Why Every New Business Needs A Content Strategy

Why Every New Business Needs A Content Strategy adsaudiencebrandbrand marketingbusinesscompanycontentcontent strategyconversionconversion trackingcustomersdigital marketinggrowth strategieslanding pagelead generationmarketingmarketing effortsmarketing strategiesmobile marketingROISEOtrafficuserswebsite

For the last few years, content marketing has become a major buzzword among digital marketers. It’s not surprising when you look at the

The Complete Guide to Getting Website Feedback from Your Customers

The Complete Guide to Getting Website Feedback from Your Customers appbotbusinesschatbotcustomersdigital marketingecommerceengagementfeedbackguest postjoturllanding pagelinkmarketingmarketing campaignmarketing effortsmarketing goalsmarketing strategiesmobilephonephone callsmssocial mediasocial media marketingsurveyuserwebsitewhatsappwhatsurl

A quick question to get your brain engaged. Are your customers happy? You might instantly jump to an answer like somewhere along the ...

Influencer Marketing: TikTok vs Instagram

Influencer Marketing: TikTok vs Instagram brandbrand marketingbusinessinfluencerinfluencer marketinginstagraminstaurljoturllinkmarketingmarketing toolsocial mediasocial media marketingtiktokurl

With both TikTok and Instagram boasting around 1 million users, both platforms have potential to be leaders in influencer marketing. ...

Link Tree is not working on Instagram? Try this instead!

Link Tree is not working on Instagram? Try this instead! branded domainbranded linksbranded shortened linksconversioncustom url shortenerfeaturesinstagraminstaurljoturllead generationlinklink managementlink monitoringlink tree alternativemonitoringsocialtracking linktracking linksurlurl shortenervanity url

Sometimes it may happen that Link Tree is not working on Instagram. If you created a link using Link Tree, maybe you have already ...

The Best Deep Link Generator Online in 2021

The Best Deep Link Generator Online in 2021 app deep linkapp deep linkingbranded linksconversion trackingCTAdeep linkdeep link generatordeep linkingdeep linksdeferred deep linksdigital marketingeasy deep linkemail marketingjoturllinklinksmarketingmobilemobile deep linkingmobile deviceomni-channel toolOmnichannelsocial mediasocial media marketingtrackingtracking linktracking linksurl

In this article we deal with a very intriguing marketing topic: the best Deep Link Generator Online, and how Deep Linking works. Deep ...

Mobile User Acquisition: Definitive Guide (Updated 2021)

Mobile User Acquisition: Definitive Guide (Updated 2021) acquisitionadsappapp deep linkingbranded linksdeep linkemailinstagraminstaurllanding pagesmarketingmobile deep linkingmobile marketingsocial networkstrackingurluser

Mobile user acquisition is getting harder and harder every year. Few can disagree with that.

The best way to create custom QR Codes to open App pages

The best way to create custom QR Codes to open App pages appapp deep linkbranded deep linkbranded domainbranded QR Codecustom qr codesdeep linkdeep link generatordeep linkingeasy deep linkjoturljoturl's qr codelanding pagesmobile deep linkingmobile devicemobile marketingqrqr code generationqr codestracking linkurl

Between 2020 and 2021 the world of Marketing has changed incredibly. The behavioral changes due to the moment we are experiencing and ...

Improve Your Link In Bio On Every Channel

Improve Your Link In Bio On Every Channel branded domainbranded domainsbranded linksbranded urlconversionCTActrinstagraminstaurljoturljoturl linklanding pageslinklink in biolinktree alternativemarketing effortmarketing strategiesmobilemobile marketingmultiple link in bioremarketing pixelsocial mediasocial media marketingsoundcloudspotifytiktoktracking linktwitchurlurl shortenervideo embedyoutube

In 2021, the use of Bio Links within their Digital Marketing strategies is constantly increasing. Knowing how to improve the Link in ...

Boost your YouTube Channel with JotUrl

Boost your YouTube Channel with JotUrl bio linkconversionCTAdeep linkdigital marketinginstaurlinstaurl videojoturllanding pagelink in biolinksmarketingmobile deep linkingmobile marketingmultiple linkretargetingsocial mediasubscribertracking linkvideoyoutubeyoutube channelyoutube ctayoutube instaurl

Youtube is an incredibly used platform to promote video content, it is the most famous in the world and boasts a huge number of users ...

THE EASIEST WAY TO CREATE A DEEP LINK TO VIMEO

THE EASIEST WAY TO CREATE A DEEP LINK TO VIMEO app deep linkconversionconversion ratedeep linkdeep linkingdeep linkseasy deep linkjoturljoturl linkslinksmobilemobile deep linkingsocial networktracking linkurlusersvideovimeo

Vimeo is one of the most popular video content platforms in the world. It was founded in 2004 to offer a digital space in which to ...

Snapchat Ads: Definitive Guide 2021

Snapchat Ads: Definitive Guide 2021 adsconversionconversion rateconversion trackingdigital marketinggdpr remarketing pixeljoturllead generationlinkmarketing strategiesremarketing pixelsnapchatsnapchat adssocial mediasocial media marketingsocial networksstrategiestracking linktracking linksurlvideo ads

With more than 250 milion daily active user, Snapchat is one of the most widely used social media in the US and worldwide.

How to Find & Add Your Retargeting Pixel ID

How to Find & Add Your Retargeting Pixel ID adrolladsanalyticsdigital marketingfacebook pixelgdpr remarketing pixelgoogle adsgoogle tag managerjoturllinkedinmarketing strategiespinterestpixelremarketingremarketing coderetargetingretargeting pixelsnapchatsocial mediasocial media marketingtiktoktrackingtracking linkurl

If you want to get 100% from your digital marketing campaigns you will need to know how to find and use Retargeting Pixels. What is a ...

Google URL Shortener – Best Alternative in 2021

Google URL Shortener – Best Alternative in 2021 analyticsbranded domainsbranded linksjoturllinkshortened urlshortenertracking linksurlurl shortenervanity url

Why it’s so important to use short links? In recent years, the need to use links with short and simple URLs has increased ...

THE EASIEST WAY TO CREATE A DEEP LINK TO TWITCH

THE EASIEST WAY TO CREATE A DEEP LINK TO TWITCH analyticsandroidappapp deep linkbranded deep linkbranded linksdeep linkdeep linksdigital marketingeasy deep linkiOSjoturllanding pagesmarketing strategiesmobile deep linkingmobile deviceopen graphtrackingtracking linktwitchtwitch videourlvideovisitors

Twitch is undoubtedly the most popular Online Streaming platform in the world. Since 2013, many gamers have become Streamers on Twitch ...

HOW TO SELL YOUR PRODUCTS ON AMAZON IN 2021

HOW TO SELL YOUR PRODUCTS ON AMAZON IN 2021 adsamazonbranded linksconversionconversion rateCTActrdeep linkdeep linkingearningsjoturllanding pageslead generationlinksmarketingmarketing goalsproduct pagesROIsocial mediastrategiestracking linksvideo

Amazon is one of the most popular platforms in the world, it has forever revolutionized the way people sell and buy products, creating ...

Get 100% From Your Brand Marketing Strategies

Get 100% From Your Brand Marketing Strategies analyticsbrandbrand marketingbranded domainbranded linksbranded shortened linkscontentconversionCTAcustom domaindeep linkingdeep linkseasy deep linkjoturllanding pagelead generationlinkmarketing campaignmarketing strategiesmobile deep linkingsuccesstrackin linkstrackingtracking link

Digital marketing is a choice used by an increasing number of businesses, agencies and companies. The Internet is undoubtedly one of ...

Beginner’s Guide on How to Use Reddit For Marketing

Beginner’s Guide on How to Use Reddit For Marketing channelshashtagsjoturllinksmarketingmarketing campaignmarketing strategiesredditsocial mediasocial media marketingsocial networks

If you’re looking for quality leads, you certainly should use social media. Social media has proven to be a great channel for ...

How to Write Powerful Blog Posts With Content Curation

How to Write Powerful Blog Posts With Content Curation audienceblogbusinesschannelscontentdigital marketingfacebookgooglejoturllinksredditsocialsocial mediasocial media marketingurl

A blog always asks for fresh content – leaving the blog writer in pursuit of original topics day after day. What if someone is to tell ...

THE EASIEST WAY TO CREATE A DEEP LINK TO YOUTUBE

THE EASIEST WAY TO CREATE A DEEP LINK TO YOUTUBE brandbranded domainbranded linkscustom domaindeep linkdeep linkingdigital marketingeasy deep linkedljoturllinkmarketingmarketing strategiesmobilemobile deep linkingmobile deviceshort linkshortened urlsmssocialsocial mediasocial media marketingsocial networkstrategiesurlvideoyoutube

YouTube is one of the most famous and visited online platforms in the world. His videos are shared and posted everywhere. When a person

How to Drive More Website Traffic with Instagram

How to Drive More Website Traffic with Instagram adsappapp deep linkbrandcampaignsCTAinfluencerinstagraminstagram deep linkinstagram storiesinstaurljoturllinklink in biolinksmultiple link in biosocialsocial mediasocial media marketingtrafficurluserswebsite

Did you know that Instagram can help to get more link juice? Yes, the platform isn’t link-friendly, but it has huge potential! As

THE EASIEST WAY TO CREATE A DEEP LINK TO AMAZON

THE EASIEST WAY TO CREATE A DEEP LINK TO AMAZON amazonandroidappapp deep linkapp deep linkingbranded domainbranded linksconversionconversion ratedeep linkdeep link to amazondeep linkingdeep linksjoturljoturl link shortenerlanding pageslinkmarketingmarketing strategiesproduct pagessocial mediaurlurl shortener

Amazon is one of the most influential platforms in the world and has forever revolutionized the buying and selling of any kind of ...

THE EASIEST WAY TO CREATE A DEEP LINK TO SNAPCHAT

THE EASIEST WAY TO CREATE A DEEP LINK TO SNAPCHAT analyticsandroiddeep linkdeep linkingeasy deep linkiOSjoturllead acquisitionlinkmarketingmobilemobile deep linkingmobile devicemobile marketingsnapchatsocial mediasocial media marketingsocial networksstrategiestargettracking link

Did you know that Snapchat can be revolutionary for your marketing strategies? Many people often tend to ignore the possibilities and ...

THE EASIEST WAY TO CREATE A DEEP LINK TO LINKEDIN

THE EASIEST WAY TO CREATE A DEEP LINK TO LINKEDIN brand reputationbranded domainbranded linksctrcustom branded linkscustom domaindeep linkdeep link generatordeep linkingdeep linkseasy deep linklinkedinlinkedin url shortenermediasocialsocial mediasocial media marketingsocial networktracking linkusersvisits

LinkedIn is a very unique social network.It has made its way through many other social media platforms, becoming the best known and ...

THE EASIEST WAY TO CREATE A DEEP LINK TO INSTAGRAM

THE EASIEST WAY TO CREATE A DEEP LINK TO INSTAGRAM conversion trackingdeep linkdeep linkingeasy deep linkinstagraminstagram deep linkinstagram story camerajoturllanding pageslinklinksmarketingmobilemobile deep linkingmobile devicemobile marketingsocialsocial mediasocial media marketingtracking linkurlurl shortenervanity url

Instagram is one of the most useful and famous social media in 2020, even very important brands ( Coca Cola, BMW, Nike, Apple, etc.) ...

THE EASIEST WAY TO CREATE A DEEP LINK TO FACEBOOK

THE EASIEST WAY TO CREATE A DEEP LINK TO FACEBOOK businessclicksconversion rateconversionsctrdeep linkdeep link to facebookdeep linkingfacebooklinkmarketingmarketing campaignmarketing goalsmobile deep linkingmobile devicesocialsocial mediasocial media marketingsocial networkstracking linkvisits

Facebook is one of the most used and important social media in 2020, that’s why understanding how to generate a Deep Link to Facebook ...

DEEP LINKING IN YOUR SMS MARKETING CAMPAIGNS

DEEP LINKING IN YOUR SMS MARKETING CAMPAIGNS conversionconversion ratectrdeep linkdeep linkingdeep linkseasy deep linkenterpriselanding pagesmarketersmarketingmarketing campaignmarketing goalsmobilephoneqr codesshort linksmstracking linkusers

In this article, we’ll talk about one of the best ways to boost your mobile campaigns. Thanks to modern Deep Linking ...

15 Amazing way to use JotURL Dynamic QR Codes

15 Amazing way to use JotURL Dynamic QR Codes billboardsbranded QR Codebusinesscodedynamic qr codegrowth strategiesjoturllanding pagelinkmarketing campaignmarketing strategiesoffline marketingonline marketingqrqr codeqr code generationqr codesstatic QR Codestrategiesurl

In 2020 it’s not possible to think of a digital marketing campaign without QR Codes or Dynamic QR Codes. QR Codes can become ...

4 Essential Growth Strategies To Take Your Online Store To The Next Level

4 Essential Growth Strategies To Take Your Online Store To The Next Level analyticsbranded domainsbranded linkbusinesscustomerse-commercegrowthgrowth strategiesjoturllinkmarketingmarketing goalsonline storeprofitssalessocial mediastrategiestestimonialstracking link

If you want to turn your online store into a successful business in 2021, you need sustained growth. Regardless of whether you’ve got a

HOW TO TRACK OFFLINE MARKETING CAMPAIGNS IN THE BEST WAY

HOW TO TRACK OFFLINE MARKETING CAMPAIGNS IN THE BEST WAY AB testinganalyticsbranded domainbranded linkbranded QR Codeconversion ratecustom branded domaincustom domaincustom urlcustom url shortenerdigital marketingfree-trialjoturllinkmarketingmarketing campaignmarketing goaloffline marketingqr codeqr code generationtrackingtracking linktrafficux deisgn

Digital Marketing, or all those market strategies that develop on online platforms and channels, are growing more and more. Digital ...

5 Quick Website Additions That Will Drive Conversions

5 Quick Website Additions That Will Drive Conversions b2bb2cbuttoncall to actionschatbotconversionconversion rateCTAcustomerse-commercelinkmarketingmarketing effortmarketing goalsmultiple conversionssalesvideowebsite

E-commerce is competitive. It doesn’t matter if you’re selling digital services or physical goods. It doesn’t matter if you’re a B2B or

LinkedIn URL Shortener

LinkedIn URL Shortener branded domainbranded linksbranded shortened linksbranded urlchrome extensioncustom branded domaincustom domaincustom linkcustom urlcustom url shortenerjoturljoturl link shortenerlinklink shortenerlinkedinlinkedin url shortenermarketing goalsshortenersocialsocial mediasocial media marketingtracking linkurlurl shortenervanity url

LinkedIn is one of the platforms that have been developing the most in recent times. Born as a social network created and designed ...

Effectively integrating CTA links into your videos

Effectively integrating CTA links into your videos bounce ratechannelsconversion rateCTACTA linkctasdigital marketingintegrationjoturllinklinksmarketing effortsmonetizeranking algorithmsocialtimetrackingtracking linksvideoyoutube

A CTA (Call To Action) is just as important as the piece of content you’re using to promote yourself. If your CTAs are not on point, ...

INSTAGRAM STORY CAMERA DEEP LINKING

INSTAGRAM STORY CAMERA DEEP LINKING brandbranded deep linkbranded domainsbranded linksbranded urlbusinessconversiondeep linkdeep link in instagram story cameradeep linkingdigital marketingeasy deep linkengagementinstagraminstagram deep linkinstagram filterinstagram storiesinstagram story camerajoturllinklinksmarketingmobilemobile deep linkingmobile marketingsocialstrategiestracking linkurl

Doing digital marketing on a professional level is a challenge that tests marketers and businessmen all over the world. The rapid ...

How to Build Deep Links into E-commerce Product Pages?

How to Build Deep Links into E-commerce Product Pages? app deep linkbacklinksbroken linksdeep linkdeep linkingdeep linkse-commerceeasy deep linkengagementjoturllinklink buildinglinksmarketingmarketing effortspagesproduct pagesproductsSEOsocialsocial mediastrategiestrafficux design

E-commerce link building strategies are the strategies that one creates for getting links to and from an online store. This links ...

DEEP LINKING FREE

DEEP LINKING FREE AB testingadvance deep linkappapp deep linkbranded domainbranded linksbusinessconversionconversion trackingCTActrdashboarddeep linkdeep link freedeep link generatordeep linkingdeep linking freedeep linksdeferred deep linksearningseasy deep linkfree deep linkfree-trialinstagraminstaurljoturllinklink healthlink managementmarketingmobilemobile deep linkingmobile devicemonitoring toolphoneplansecuritysocialsocial mediasocial optinsupporttargettooltracking linktracking linkstrafficuri schemeutmutm builderutm viewerwhatsurl

Deep Linking is an operation increasingly used within multimedia campaigns. And precisely for this reason, the demand for Deep Linking ...

Six Creative Ways to Improve your Conversion Rate

Six Creative Ways to Improve your Conversion Rate businessconversionconversion rateconversion trackingconversionscustomersfunneljoturllinkmarketingmarketing effortmarketing goalsmultiple conversionsproductsremarketingROIsalessales funneltestimonialsurl

Hey, you—look at us! No—we want your attention! Don’t focus on them—see how much better we are! Though the average person might not be ...

MailChimp and Social Opt-in XL

MailChimp and Social Opt-in XL CTActasemailemail marketingjoturlleadlead generationlinklinksmailmailchimpmarketingqualified leadssocialsocial optinsocial optin xltracking linkwebhooks

JotURL has released a large amount of Webhooks (ActiveCampaign, MailChimp, Drift, Zapier, etc.) a few months ago. In addition to this, ...

What Really Converts? The Data Behind Landing Page Success

What Really Converts? The Data Behind Landing Page Success call to actionsconversionconversion rateCTAdigital marketingjoturllanding pageslinkmarketersmarketingsecuritysuccesstrackingtracking linkstraffic

Data backed Landing Page Success Techniques to Know Conversion Trends The basic web analysis fails to give you true insights into what ...

THE BEST WAY TO CREATE UTM PARAMETERS

THE BEST WAY TO CREATE UTM PARAMETERS custom parametersjoturllinkmarketingprojectsocial mediastrategiestrackingtracking linksurlutmutm builderutm campaignsutm customutm parameters

Using UTM parameters is fundamental for digital marketing and social media marketing. They are a precious piece of a whole series of ...

Mobile Deep Linking

Mobile Deep Linking appapp deep linkapp deep linkingdeep linkdeep linkingeasy deep linkjoturllinkmobilemobile deep linkingsocial mediatracking linkuniversal link

In 2020 the use of Mobile Deep Linking is vital for every Marketing project and operation. Thanks to Deep Linking and its applications ...

Omnichannel Marketing Guide – 3 Steps for Implementation

Omnichannel Marketing Guide – 3 Steps for Implementation businesschannelsdeep linkingdigital marketinginstaurljoturllead generationmarketingmarketing effortmetricsOmnichannelROIsocial mediatool

Today, customers need a variety of touchpoints across several channels trustworthy enough to purchase. With customers becoming more and

Joturl’s WordPress Plugin

Joturl’s WordPress Plugin branded linksbranded shortened linkscustom branded domaincustom urldomainjoturljoturl link shortenerlinkpluginshort linkurl shortenerWordPress

What should be one of the priorities of a marketer or a company that wants to start a campaign on online platforms? A good starting ...

JOTURL: THE BEST URL SHORTENER CHROME EXTENSION

JOTURL: THE BEST URL SHORTENER CHROME EXTENSION branded domainbranded linksbranded shortened linkschrome extensioncustom urlcustom url shortenerjoturllinklinksshort linksshortened urlsocial mediatracking linksurlurl shortenerurlsvanity url

Using programs or URL Shorteners online is essential for personal branding. But in some cases, using a URL shortener chrome extension ...

How to choose your branded domain.

How to choose your branded domain. brandbranded domainbranded linksctrcustom domaincustom urldeep linkingdomaindomain nameextensionslinksmarketing goalspremium domainsocial mediaSSL certificateurlvanity url

Sometimes choosing your branded domain name isn’t easy. Which name should I use? Which extension? Where should I buy it? For what

How to set up your branded domain with JotURL

How to set up your branded domain with JotURL branded domainbranded domainsbranded linksctrdeep linkdnsdns propagationdomainhttpsjoturllink trustsecuritysettingsSSL certificatesubdomainthird level domain

Using your own branded domain for your tracking links is very important to improve your marketing campaigns. Associating a branded ...

Conversion Tracking : Everything you need to know

Conversion Tracking : Everything you need to know AB testingaffiliate linksanalyticsclicksconversionconversion rateconversion trackingdynamic conversionjoturlleadsmultiple conversionparameterssalestrackingtracking links

Conversion tracking is essential to improve and boost your business and your activity. Any digital campaign, any marketing strategy ...

5 Marketing Analysis Reports You Need for Better Results

5 Marketing Analysis Reports You Need for Better Results analysisanalyticsconversionsctrkpilead generationmarketingmarketing goalsmetricsmonitoringreportsSEOsocial

Big or small, every business wants to generate leads and revenue. For that, we do a market analysis and come up with a marketing ...

Amazon Affiliate Link

Amazon Affiliate Link affiliate linksaffiliate marketingamazonappconversionCTAdeep linkdeep linkingearningseasy deep linkjoturllanding pageslinkmarketingmobilepixelproductsretargetingsharesocialtracking link

More and more people are taking advantage of Affiliate Marketing to increase their earnings. It’s not so uncommon for users to get an ...

How To Generate Leads In The Best Way

How To Generate Leads In The Best Way analyticscall to actionsconversionconversion trackingCTAjoturllanding pagesleadlead acquisitionlead generationqualified leadssocialSocial Opt-intracking linkurl

Understanding how to generate leads in the best possible way is an essential step for your marketing campaign. Lead generation is one ...

The Priceless Value Of A Custom URL Shortener

The Priceless Value Of A Custom URL Shortener branded domainbranded linksCTAcustom linkcustom urlcustom url shortenercustomizejoturllinklink managementmarketingremarketingshortened urltracking linkurlurl shortenervanity url

In 2020, being able to use a custom URL shortener is essential in order to create excellent digital marketing strategies. In this ...

How to generate a QR Code: JotURL is the best solution

How to generate a QR Code: JotURL is the best solution adsbranded domainsbranded linksjoturllinksqr codeqr code generationsocialtracking linksvanity url

What are QR Codes? Finding out how to generate a QR Code is very important right now. This technology, in fact, is suitable for the use

THE BEST LINK  MANAGEMENT TOOL

THE BEST LINK MANAGEMENT TOOL joturllink managementlink monitoringtracking links

In this article we want to talk to you about a really important topic that is often ignored: discover one of the most incredible link ...

What Is Deep Link – Everything You Need To Know

What Is Deep Link – Everything You Need To Know deep linkdeep linkingjoturltracking links

What Is Deep Link? Deep Linking is an increasingly used technology in online marketing and advertising campaigns, but it is not always ...

THE BEST PIXELME ALTERNATIVE

THE BEST PIXELME ALTERNATIVE branded linksconversion trackingCTApixelmeremarketing

This article will briefly explain why JotURL is the best PixelMe alternative, only 5 points from the checklist will be enough to ...

HOW TO CHOOSE THE BEST BRANDED LINK SHORTENER: GUIDE + CHECKLIST

HOW TO CHOOSE THE BEST BRANDED LINK SHORTENER: GUIDE + CHECKLIST brandend linkshortnertracking linksvanity url

How to choose the best branded link shortener is never a simple thing. There are a lot of factors to consider, understand what we need,

The Best Linktree Alternative

The Best Linktree Alternative

Are you looking for an easy to use alternative to Linktree?  Redirecting traffic from your Instagram profile to your email list or

Bitly Enterprise Pricing

Bitly Enterprise Pricing

If you’re a corporation, agency, or an affiliate marketer seriously growing your brand and your customer reach, you need a link ...

How to Track Affiliate Links: Definitive Guide

How to Track Affiliate Links: Definitive Guide

Why bother tracking affiliate links? After all, many affiliate programs have their own dashboards and reports that show the number of ...

How to Add A Facebook Retargeting Pixel to Amazon Product pages

How to Add A Facebook Retargeting Pixel to Amazon Product pages adsamazonchrome extensionconversion trackingfacebookfacebook pixelfacebook retargetingjoturllinkproduct pagesproductsremarketingremarketing coderetargeting pixelROIsocial mediasocial media marketingtracking linktrends report

There’s no doubt that Facebook is one of the best channels for marketing your products. In their 2018 Internet Trends Report, venture ...

What Is a Vanity URL and Why Is It Important?

What Is a Vanity URL and Why Is It Important? brandbranded linksmarketingtracking linksvanity url

A vanity URL is a unique web address that is branded for marketing purposes. A vanity URL takes a long address and converts it into a ...

How to set a dynamic value for your conversions

How to set a dynamic value for your conversions BigCommerceconversion trackingconversionsdynamicecommerceMagentomultiple conversionsShopifySquarespacevalueWooCommerce

JotUrl provides users with dynamic conversion tracking capabilities.

DARK SOCIAL: THE DARK SIDE OF THE WEB

DARK SOCIAL: THE DARK SIDE OF THE WEB CTAremarketingsocialtracking links

What is Dark Social? Dark social it’s the type of traffic that comes from sources like Facebook Messenger, Whatsapp, etc.

LEAD GENERATION – 100 LEADS IN 10 MINUTES

LEAD GENERATION – 100 LEADS IN 10 MINUTES CTAlead generationtracking links

“They’re kidding” “It’s the classic sensationalist phrase” NO.

TRACKING LINK: WHY IS IT SO IMPORTANT?

TRACKING LINK: WHY IS IT SO IMPORTANT? tracking link

THE IMPORTANCE OF TRACKING LINK We know what you’re asking

Featured Posts

The Best URLGenius Alternative in 2024

The Best URLGenius Alternative in 2024

Year 2024. The world of digital marketing is moving more and more towards the mobile sector, it is undeniable, there are many studies that confirm this. Just see our own daily habits, how much time do you spend in front of the phone every day? How much time do you...